제품 > 항체 > 다중클론항체(pAb)

TMED3 Rabbit pAb (A17665)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using TMED3 Rabbit pAb (A17665) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - TMED3 Rabbit pAb (A17665)

Immunohistochemistry analysis of paraffin-embedded rat kidney using TMED3 Rabbit pAb (A17665) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using TMED3 Rabbit pAb (A17665) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse lung using TMED3 Rabbit pAb (A17665) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - TMED3 Rabbit pAb (A17665)

Immunofluorescence analysis of A431 cells using TMED3 Rabbit pAb (A17665) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	TMED3 Rabbit pAb
Catalog No.	A17665
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to be involved in Golgi organization; endoplasmic reticulum to Golgi vesicle-mediated transport; and intracellular protein transport. Located in Golgi apparatus; endoplasmic reticulum; and endoplasmic reticulum-Golgi intermediate compartment.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-180 of human TMED3 (NP_031390.1).
Sequence	PCGAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVEDPQGNTIYRETKKQYDSFTYRAEVKGVYQFCFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVS
Gene ID
Swiss Prot
Synonyms	p26; P24B; p24g4; C15orf22; p24gamma4; TMED3
Calculated MW	25kDa
Observed MW	25kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	MCF7, A-549, A-431
Cellular location	COPI vesicle coat, COPII-coated ER to Golgi transport vesicle, endoplasmic reticulum, endoplasmic reticulum-Golgi intermediate compartment, Golgi apparatus, transport vesicle