제품 > 항체 > 다중클론항체(pAb)

TMEM18 Rabbit pAb (A18541)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of various lysates using TMEM18 pAb (A18541) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Overview

Product name	TMEM18 Rabbit pAb
Catalog No.	A18541
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable DNA binding activity. Involved in cell migration. Located in nuclear membrane.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 40-100 of human TMEM18 (NP_690047.2).
Sequence	LLTCLSSRSYRLQIGHFLCLVILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAP
Gene ID
Swiss Prot
Synonyms	lncND; TMEM18
Calculated MW	16kDa
Observed MW	23kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, A-549, Rat kidney
Cellular location	cytoplasm, nuclear membrane