제품 > 항체 > 다중클론항체(pAb)

TMEM25 Rabbit pAb (A14370)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using TMEM25 Rabbit pAb (A14370) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - TMEM25 Rabbit pAb (A14370)

Immunofluorescence analysis of L929 cells using TMEM25 Rabbit pAb (A14370) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	TMEM25 Rabbit pAb
Catalog No.	A14370
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to be involved in negative regulation of excitatory postsynaptic potential and regulation of protein stability. Predicted to be located in late endosome and lysosome.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 223-322 of human TMEM25 (NP_001137506.1).
Sequence	APGPSRHPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVLGYIYRVSSVSSDEIWL
Gene ID
Swiss Prot
Synonyms	TMEM25
Calculated MW	39kDa
Observed MW	50kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	U-87MG, OVCAR3, LO2, Mouse brain, Mouse kidney, Rat brain, Rat kidney
Cellular location	Cell membrane, Secreted, Single-pass type I membrane protein