제품 > 항체 > 다중클론항체(pAb)

TNFAIP1 Rabbit pAb (A17543)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from K-562 cells, using TNFAIP1 Rabbit pAb (A17543) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	TNFAIP1 Rabbit pAb
Catalog No.	A17543
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene was identified as a gene whose expression can be induced by the tumor necrosis factor alpha (TNF) in umbilical vein endothelial cells. Studies of a similar gene in mouse suggest that the expression of this gene is developmentally regulated in a tissue-specific manner.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 90-160 of human TNFAIP1 (NP_066960.1).
Sequence	DTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERLIESSTKPVVKL
Gene ID
Swiss Prot
Synonyms	B12; B61; EDP1; BTBD34; hBACURD2; TNFAIP1
Calculated MW	36kDa
Observed MW	36kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	K-562
Cellular location	cytoplasm, cytosol, endosome, nucleus