TNFAIP3 Rabbit pAb (A13637)

Publication (1) Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

ABclonal:Immunofluorescence - TNFAIP3 Rabbit pAb (A13637)

Immunofluorescence analysis of U2OS cells using TNFAIP3 antibody (A13637). Blue: DAPI for nuclear staining.

Overview

Product name	TNFAIP3 Rabbit pAb
Catalog No.	A13637
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

This gene was identified as a gene whose expression is rapidly induced by the tumor necrosis factor (TNF). The protein encoded by this gene is a zinc finger protein and ubiqitin-editing enzyme, and has been shown to inhibit NF-kappa B activation as well as TNF-mediated apoptosis. The encoded protein, which has both ubiquitin ligase and deubiquitinase activities, is involved in the cytokine-mediated immune and inflammatory responses. Several transcript variants encoding the same protein have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human TNFAIP3 (NP_006281.1).
Sequence	MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTPMARSGLQYNS
Gene ID
Swiss Prot
Synonyms	A20; AISBL; AIFBL1; OTUD7C; TNFA1P2
Calculated MW	90kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples
Cellular location	Cytoplasm, Lysosome, Nucleus
Customer validation	IF(Mus musculus)