제품 > 항체 > 다중클론항체(pAb)

TNFAIP3 Rabbit pAb (A2127)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using (A2127) at 1:500 dilution.THP-1 cells were treated by PMA/TPA (200 nM) at 37℃ for 15 minutes after serum-starvation overnight.THP-1 cells were treated by LPS (1 μg/ml) at 37℃ for 8 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 40s.

Western blot analysis of lysates from Rat thymus using TNFAIP3 Rabbit pAb(A2127) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:20s.

ABclonal:Immunohistochemistry - TNFAIP3 Rabbit pAb (A2127)

Immunohistochemistry analysis of paraffin-embedded Human colon using TNFAIP3 Rabbit pAb (A2127) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human lung cancer using TNFAIP3 Rabbit pAb (A2127) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat lung using TNFAIP3 Rabbit pAb (A2127) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat spleen using TNFAIP3 Rabbit pAb (A2127) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	TNFAIP3 Rabbit pAb
Catalog No.	A2127
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene was identified as a gene whose expression is rapidly induced by the tumor necrosis factor (TNF). The protein encoded by this gene is a zinc finger protein and ubiqitin-editing enzyme, and has been shown to inhibit NF-kappa B activation as well as TNF-mediated apoptosis. The encoded protein, which has both ubiquitin ligase and deubiquitinase activities, is involved in the cytokine-mediated immune and inflammatory responses. Several transcript variants encoding the same protein have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 600-738 of human TNFAIP3 (NP_006281.1).
Sequence	DRTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASGKVSPTASRFQNTIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRPKCARASCKNILACRSEELCMECQH
Gene ID
Swiss Prot
Synonyms	A20; AISBL; AIFBL1; OTUD7C; TNFA1P2; TNFAIP3
Calculated MW	90kDa
Observed MW	90kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	THP-1 treated by TPA and LPS, Rat thymus
Cellular location	Cytoplasm, Lysosome, Nucleus
Customer validation	WB(Homo sapiens)