제품 > 항체 > 다중클론항체(pAb)

TNFAIP8L2 Rabbit pAb (A13698)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using TNFAIP8L2 Rabbit pAb (A13698) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - TNFAIP8L2 Rabbit pAb (A13698)

Immunofluorescence analysis of C6 cells using TNFAIP8L2 Rabbit pAb (A13698) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using TNFAIP8L2 Rabbit pAb (A13698) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using TNFAIP8L2 Rabbit pAb (A13698) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - TNFAIP8L2 Rabbit pAb (A13698)

Immunoprecipitation analysis of 25 μg extracts of Mouse spleen cells using 3 μg TNFAIP8L2 antibody (A13698). Western blot was performed from the immunoprecipitate using TNFAIP8L2 antibody (A13698) at a dilution of 1:1000.

Overview

Product name	TNFAIP8L2 Rabbit pAb
Catalog No.	A13698
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to be involved in negative regulation of T cell activation and negative regulation of inflammatory response. Predicted to be active in cytoplasm.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human TNFAIP8L2 (NP_078851.2).
Sequence	MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL
Gene ID
Swiss Prot
Synonyms	TIPE2; TNFAIP8L2
Calculated MW	21kDa
Observed MW	18kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 25μg-100μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	THP-1, Mouse thymus, Mouse spleen, Rat spleen
Cellular location	cytoplasm
Customer validation	WB(Rattus norvegicus) IHC(Rattus norvegicus)