제품 > 항체 > 다중클론항체(pAb)

TNF RII/TNFRSF1B/CD120b Rabbit pAb (A24513)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from L929 cells using TNF RII/TNFRSF1B/CD120b Rabbit pAb (A24513) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	TNF RII/TNFRSF1B/CD120b Rabbit pAb
Catalog No.	A24513
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables tumor necrosis factor-activated receptor activity. Involved in several processes, including negative regulation of extracellular matrix constituent secretion; regulation of nervous system development; and semi-lunar valve development. Acts upstream of or within several processes, including RNA destabilization; apoptotic signaling pathway; and negative regulation of inflammatory response. Located in membrane raft. Is expressed in several structures, including blood; dorsal aorta; extraembryonic component; genitourinary system; and liver. Human ortholog(s) of this gene implicated in several diseases, including Parkinsonism; acne; bone disease (multiple); glomerulonephritis (multiple); and lung disease (multiple). Orthologous to human TNFRSF1B (TNF receptor superfamily member 1B).

Immunogen information

Immunogen	Recombinant Protein corresponding to a sequence within amino acids 23-258 of mouse TNF RII/TNFRSF1B/CD120b(NP_035740.2).
Sequence	VPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLYVSQPEPTRSQPLDQEPGPSQTPSILTSLGSTPIIEQSTKGG
Gene ID
Swiss Prot
Synonyms	p75; TNFBR; Tnfr2; CD120b; TNF-R2; TNFR80; TNFRII; Tnfr-1; TNF-R75; TNF-R-II; TNF-alphaR2; TNFalpha-R2; TNF RII/TNFRSF1B/CD120b
Calculated MW	50kDa
Observed MW	50kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	L929
Cellular location	Secreted and Cell membrane.