제품 > 항체 > 다중클론항체(pAb)

TNFα Rabbit pAb (A23264)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Western blot analysis of Recombinant Rat TNF-alpha Protein (RP01322), using TNFα Rabbit pAb (A23264) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 5ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of lysates from THP-1 cells, using TNFα Rabbit pAb (A23264) at 1:2000 dilution. THP-1 cells were treated by PMA/TPA (200 nM) at 37℃ for 15 minutes and LPS (1 μg/ml) at 37℃ for 6 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

Western blot analysis of lysates from RAW 264.7 cells, using TNFα Rabbit pAb (A23264) at 1:2000 dilution. Raw 264. 7 cells were treated by LPS (1 μg/ml) at 37℃ for 8 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

Overview

Product name	TNFα Rabbit pAb
Catalog No.	A23264
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables tumor necrosis factor receptor binding activity. Involved in several processes, including positive regulation of cell communication; positive regulation of macromolecule metabolic process; and positive regulation of neuron death. Located in several cellular components, including external side of plasma membrane; extracellular space; and neuronal cell body. Used to study several diseases, including cerebrovascular disease (multiple); liver disease (multiple); peptic esophagitis; perinatal necrotizing enterocolitis; and periventricular leukomalacia. Biomarker of several diseases, including brain disease (multiple); congestive heart failure (multiple); inflammatory bowel disease (multiple); lung disease (multiple); and non-alcoholic fatty liver disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including artery disease (multiple); autoimmune disease (multiple); eye disease (multiple); lung disease (multiple); and skin disease (multiple). Orthologous to human TNF (tumor necrosis factor).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 80-235 of rat TNFα (NP_036807.1).
Sequence	LRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
Gene ID
Swiss Prot
Synonyms	Tnfa; RATTNF; TNF-alpha; TNFα
Calculated MW	26kDa
Observed MW	17kDa/26kDa

Applications

Reactivity	Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	THP-1 treated by TPA and LPS, Recombinant Rat TNF-alpha Protein, Raw 264.7 treated by LPS
Cellular location