제품 > 항체 > 다중클론항체(pAb)

TNK2 Rabbit pAb (A25232)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Immunofluorescence analysis of paraffin-embedded Human breast cancer tissue using TNK2 Rabbit pAb (A25232) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunofluorescence analysis of NIH/3T3 cells using TNK2 Rabbit pAb (A25232) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	TNK2 Rabbit pAb
Catalog No.	A25232
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a tyrosine kinase that binds Cdc42Hs in its GTP-bound form and inhibits both the intrinsic and GTPase-activating protein (GAP)-stimulated GTPase activity of Cdc42Hs. This binding is mediated by a unique sequence of 47 amino acids C-terminal to an SH3 domain. The protein may be involved in a regulatory mechanism that sustains the GTP-bound active form of Cdc42Hs and which is directly linked to a tyrosine phosphorylation signal transduction pathway. Several alternatively spliced transcript variants have been identified from this gene, but the full-length nature of only two transcript variants has been determined.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 939-1038 of human TNK2 (NP_005772.3).
Sequence	ATARLPQRGCPGDGPEAGRPADKIQMAMVHGVTTEECQAALQCHGWSVQRAAQYLKVEQLFGLGLRPRGECHKVLEMFDWNLEQAGCHLLGSWGPAHHKR
Gene ID
Swiss Prot
Synonyms	ACK; ACK1; ACK-1; p21cdc42Hs; TNK2
Calculated MW	115kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	Cell junction, Cell membrane, Cytoplasmic side, Cytoplasmic vesicle, Cytoplasmic vesicle membrane, Endosome, Membrane, Nucleus, Peripheral membrane protein, adherens junction, clathrin-coated pit, clathrin-coated vesicle