Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | TNNT3 Rabbit pAb |
---|---|
Catalog No. | A15323 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 147-256 of human TNNT3 (NP_001036246.1). |
---|---|
Sequence | SMGANYSSYLAKADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK |
Gene ID | |
Swiss Prot | |
Synonyms | TNTF; DA2B2; beta-TnTF; TNNT3 |
Calculated MW | 32kDa |
Observed MW | 37kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse skeletal muscle, Rat skeletal muscle, Rat lung |
Cellular location | cytosol |
Customer validation | WB(Sus scrofa) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A15323? Please let us know so that we can cite the reference in this datasheet.