제품 > 항체 > 다중클론항체(pAb)

TOM1L1 Rabbit pAb (A17602)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using TOM1L1 Rabbit pAb (A17602) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	TOM1L1 Rabbit pAb
Catalog No.	A17602
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables clathrin binding activity and protein kinase binding activity. Involved in negative regulation of mitotic nuclear division; positive regulation of protein phosphorylation; and signal transduction. Located in cytosol and endosome.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 250-350 of human TOM1L1 (NP_005477.2).
Sequence	QERIMDLLVVVENEDVTVELIQVNEDLNNAILGYERFTRNQQRILEQNKNQKEATNTTSEPSAPSQDLLDLSPSPRMPRATLGELNTMNNQLSGLNFSLPS
Gene ID
Swiss Prot
Synonyms	SRCASM; TOM1L1
Calculated MW	53kDa
Observed MW	53kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T, HT-29, SGC-7901, Mouse kidney, Rat kidney
Cellular location	Cytoplasm, Cytoplasmic side, Endosome membrane, Golgi apparatus, Golgi stack, Membrane, Peripheral membrane protein