제품 > 항체 > 단일클론항체(mAb)

TOMM40 Rabbit mAb (A24644)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using TOMM40 Rabbit mAb (A24644) at 1:4800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - TOMM40 Rabbit mAb (A24644)

Immunohistochemistry analysis of TOMM40 in paraffin-embedded human colon carcinoma using TOMM40 Rabbit mAb (A24644) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of TOMM40 in paraffin-embedded human liver using TOMM40 Rabbit mAb (A24644) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of TOMM40 in paraffin-embedded mouse colon using TOMM40 Rabbit mAb (A24644) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of TOMM40 in paraffin-embedded mouse kidney using TOMM40 Rabbit mAb (A24644) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of TOMM40 in paraffin-embedded rat liver using TOMM40 Rabbit mAb (A24644) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - TOMM40 Rabbit mAb (A24644)

Confocal imaging of HeLa cells using TOMM40 Rabbit mAb (A24644, at dilution of 1:300) (red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Confocal imaging of NIH/3T3 cells using TOMM40 Rabbit mAb (A24644, at dilution of 1:300) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Overview

Product name	TOMM40 Rabbit mAb
Catalog No.	A24644
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63318

Background

The protein encoded by this gene is localized in the outer membrane of the mitochondria. It is the channel-forming subunit of the translocase of the mitochondrial outer membrane (TOM) complex that is essential for import of protein precursors into mitochondria. Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human TOMM40 (NP_001122388.1).
Sequence	MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKC
Gene ID
Swiss Prot
Synonyms	TOM40; PEREC1; C19orf1; PER-EC1; D19S1177E; TOMM40
Calculated MW	38kDa
Observed MW	39kDa/41kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:5000 IHC-P 1:100 - 1:500 IF/ICC 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, NIH/3T3
Cellular location	Mitochondrion outer membrane, Multi-pass membrane protein