제품 > 항체 > 다중클론항체(pAb)

TRAF6BP/TAX1BP1 Rabbit pAb (A17039)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Immunohistochemistry analysis of paraffin-embedded human lung cancer using TRAF6BP/TAX1BP1 Rabbit pAb (A17039) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human breast cancer using TRAF6BP/TAX1BP1 Rabbit pAb (A17039) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	TRAF6BP/TAX1BP1 Rabbit pAb
Catalog No.	A17039
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a HTLV-1 tax1 binding protein. The encoded protein interacts with TNFAIP3, and inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. Degradation of this protein by caspase-3-like family proteins is associated with apoptosis induced by TNF. This protein may also have a role in the inhibition of inflammatory signaling pathways. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 709-789 of human TRAF6BP/TRAF6BP/TAX1BP1 (NP_006015.4).
Sequence	QHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD
Gene ID
Swiss Prot
Synonyms	T6BP; TXBP151; CALCOCO3; TRAF6BP/TAX1BP1
Calculated MW	91kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Immunohistochemistry
Positive samples
Cellular location	cytosol, extracellular exosome