제품 > 항체 > 단일클론항체(mAb)

TRAPPC2 Rabbit mAb (A20890)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using TRAPPC2 Rabbit mAb (A20890) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - TRAPPC2 Rabbit mAb (A20890)

Immunohistochemistry analysis of TRAPPC2 in paraffin-embedded mouse colon tissue using TRAPPC2 Rabbit mAb (A20890) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TRAPPC2 in paraffin-embedded human breast tissue using TRAPPC2 Rabbit mAb (A20890) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TRAPPC2 in paraffin-embedded mouse brain tissue using TRAPPC2 Rabbit mAb (A20890) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TRAPPC2 in paraffin-embedded rat testis tissue using TRAPPC2 Rabbit mAb (A20890) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TRAPPC2 in paraffin-embedded rat brain tissue using TRAPPC2 Rabbit mAb (A20890) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	TRAPPC2 Rabbit mAb
Catalog No.	A20890
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2843

Background

The protein encoded by this gene is thought to be part of a large multi-subunit complex involved in the targeting and fusion of endoplasmic reticulum-to-Golgi transport vesicles with their acceptor compartment. In addition, the encoded protein can bind c-myc promoter-binding protein 1 and block its transcriptional repression capability. Mutations in this gene are a cause of spondyloepiphyseal dysplasia tarda (SEDT). A processed pseudogene of this gene is located on chromosome 19, and other pseudogenes are found on chromosomes 8 and Y. Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TRAPPC2 (P0DI81).
Sequence	MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRFIMLHDIRQEDGIKNFFT
Gene ID
Swiss Prot
Synonyms	SEDL; SEDT; MIP2A; TRS20; ZNF547L; hYP38334; TRAPPC2P1; TRAPPC2
Calculated MW	16kDa
Observed MW	14kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	SKOV3, PC-3, SH-SY5Y, Mouse brain, Mouse thymus, Rat brain
Cellular location	Cytoplasm, Endoplasmic reticulum, Golgi apparatus, Nucleus, perinuclear region