제품 > 항체 > 단일클론항체(mAb)

TRPM8 Rabbit mAb (A4269)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using TRPM8 Rabbit mAb (A4269) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Overview

Product name	TRPM8 Rabbit mAb
Catalog No.	A4269
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0947

Background

Predicted to enable ligand-gated calcium channel activity. Predicted to be involved in calcium ion transmembrane transport and positive regulation of cold-induced thermogenesis. Predicted to act upstream of or within several processes, including cellular calcium ion homeostasis; response to cold; and thermoception. Located in plasma membrane.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human TRPM8 (Q7Z2W7).
Sequence	FRSVIYEPYLAMFGQVPSDVDGTTYDFAHCTFTGNESKPLCVELDEHNLPRFPEWITIPLVCIYMLSTNILLVNLLVAMFGYTVGTVQENNDQVWKFQRYF
Gene ID
Swiss Prot
Synonyms	TRPP8; LTRPC6; trp-p8; LTrpC-6; TRPM8
Calculated MW	128kDa
Observed MW	110kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	PC-3, MCF7
Cellular location	Cell membrane, Endoplasmic reticulum membrane, Membrane raft
Customer validation	WB(Mus musculus, Homo sapiens)