제품 > 항체 > 다중클론항체(pAb)

TRPV2 Rabbit pAb (A12367)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using TRPV2 Rabbit pAb (A12367) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	TRPV2 Rabbit pAb
Catalog No.	A12367
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes an ion channel that is activated by high temperatures above 52 degrees Celsius. The protein may be involved in transduction of high-temperature heat responses in sensory ganglia. It is thought that in other tissues the channel may be activated by stimuli other than heat.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 655-764 of human TRPV2 (NP_057197.2).
Sequence	DSWSIWKLQKAISVLEMENGYWWCRKKQRAGVMLTVGTKPDGSPDERWCFRVEEVNWASWEQTLPTLCEDPSGAGVPRTLENPVLASPPKEDEDGASEENYVPVQLLQSN
Gene ID
Swiss Prot
Synonyms	VRL; VRL1; VRL-1; TRPV2
Calculated MW	86kDa
Observed MW	86kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	A375, SKOV3, 22Rv1, BxPC-3
Cellular location	Cell membrane, Cytoplasm, Melanosome, Multi-pass membrane protein