제품 > 항체 > 다중클론항체(pAb)

TSPAN17 Rabbit pAb (A15423)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of lysates from mouse stomach, using TSPAN17 Rabbit pAb (A15423) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Overview

Product name	TSPAN17 Rabbit pAb
Catalog No.	A15423
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the transmembrane 4 superfamily. It is characterized by four tetraspanin transmembrane segments. The function of this gene has not yet been determined.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 116-234 of human TSPAN17 (NP_001006617.2).
Sequence	VFKDWIRDQLNLFINNNVKAYRDDIDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRERCGVPFSCCVRDPAEDVLNTQCGYDVRLKLELEQQGFIHTKGCVGQFEKWLQDN
Gene ID
Swiss Prot
Synonyms	FBX23; FBXO23; TM4SF17; TSPAN17
Calculated MW	30kDa
Observed MW	35kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:200 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse stomach
Cellular location	Membrane, Multi-pass membrane protein