Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | TSPAN3 Rabbit pAb |
---|---|
Catalog No. | A14833 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 105-210 of human TSPAN3 (NP_005715.1). |
---|---|
Sequence | YVYRAKVENEVDRSIQKVYKTYNGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKKLQEIMM |
Gene ID | |
Swiss Prot | |
Synonyms | TM4-A; TM4SF8; TSPAN-3; TSPAN3 |
Calculated MW | 28kDa |
Observed MW | 28kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse small intestine |
Cellular location | Membrane, Multi-pass membrane protein |
Customer validation | WB(Chlorocebus aethiops,Homo sapiens,Sus scrofa) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A14833? Please let us know so that we can cite the reference in this datasheet.