제품 > 항체 > 다중클론항체(pAb)

TSPAN7 Rabbit pAb (A6417)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of extracts of Mouse spleen, using TSPAN7 antibody (A6417) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - TSPAN7 Rabbit pAb (A6417)

Immunofluorescence analysis of Mouse pancreas cells using TSPAN7 Rabbit pAb (A6417) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of Rat Pancreas cells using TSPAN7 Rabbit pAb (A6417) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	TSPAN7 Rabbit pAb
Catalog No.	A6417
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and may have a role in the control of neurite outgrowth. It is known to complex with integrins. This gene is associated with X-linked cognitive disability and neuropsychiatric diseases such as Huntington's chorea, fragile X syndrome and myotonic dystrophy.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human TSPAN7 (NP_004606.2).
Sequence	AVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRF
Gene ID
Swiss Prot
Synonyms	A15; MXS1; CD231; MRX58; CCG-B7; TM4SF2; XLID58; TALLA-1; TM4SF2b; DXS1692E
Calculated MW	28kDa
Observed MW	28kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse spleen
Cellular location	Membrane, Multi-pass membrane protein