Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using T-bet/Tbx21 Rabbit PolymAb® (A23414PM)at 1:5000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): U-937
Exposure time: 10s.
Western blot analysis of lysates from Mouse thymus using T-bet/Tbx21 Rabbit PolymAb® (A23414PM) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.
Immunohistochemistry analysis of paraffin-embedded Human peripheral T-cell lymphoma tissue using T-bet/Tbx21 Rabbit PolymAb® (A23414PM) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human anaplastic large cell lymphoma tissue using T-bet/Tbx21 Rabbit PolymAb® (A23414PM) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using T-bet/Tbx21 Rabbit PolymAb® (A23414PM) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using T-bet/Tbx21 Rabbit PolymAb® (A23414PM) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunoprecipitation of T-bet/Tbx21 from 400 µg extracts of NK-92 cells was performed using 1 µg of T-bet/Tbx21 Rabbit PolymAb (A23414PM). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using T-bet/Tbx21 Rabbit PolymAb (A23414PM) at a dilution of 1:1000.
| Product name | T-bet/Tbx21 Rabbit PolymAb® |
|---|---|
| Catalog No. | A23414PM |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC61889_ARC61564 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 322-535 of human T-bet/Tbx21(NP_037483.1). |
|---|---|
| Sequence | KGFRENFESMYTSVDTSIPSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYYRGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPESSDSGLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPN |
| Gene ID | |
| Swiss Prot | |
| Synonyms | TBET; IMD88; T-PET; T-bet; TBLYM |
| Calculated MW | 58kDa |
| Observed MW | 70kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunoprecipitation |
| Positive samples | NK-92, Mouse thymus |
| Cellular location | Nucleus, nucleus. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
i_FC_01.jpg?t=1704936151)
Y_FC_01.jpg?t=1704936155)
