제품 > 항체 > 단일클론항체(mAb)

T-bet/Tbx21 Rabbit mAb (A25647)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using T-bet/Tbx21 Rabbit mAb (A25647) at 1:1500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): HeLa.
Exposure time: 30s.

ABclonal:Immunohistochemistry - T-bet/Tbx21 Rabbit mAb (A25647)

Immunohistochemistry analysis of paraffin-embedded Human liver (negative control sample) tissue using T-bet/Tbx21 Rabbit mAb (A25647) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human peripheral T cell lymphoma tissue using T-bet/Tbx21 Rabbit mAb (A25647) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using T-bet/Tbx21 Rabbit mAb (A25647) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Flow CytoMetry - T-bet/Tbx21 Rabbit mAb (A25647)

Flow cytometry: 1X10^6 HeLa cells (negative control, left) and NK-92 cells (right) were intracellularly-stained with T-bet/Tbx21 Rabbit mAb (A25647, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by FITC conjugated goat anti-Rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 NK-92 cells were intracellularly-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or T-bet/Tbx21 Rabbit mAb (A25647, 2 μg/mL, right), followed by FITC conjugated goat anti-Rabbit pAb staining.

Overview

Product name	T-bet/Tbx21 Rabbit mAb
Catalog No.	A25647
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61886

Background

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 322-535 of human T-bet/Tbx21(NP_037483.1).
Sequence	KGFRENFESMYTSVDTSIPSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYYRGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPESSDSGLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPN
Gene ID
Swiss Prot
Synonyms	TBX21; T-PET; T-bet; TBET; TBLYM; T-box 21
Calculated MW	58kDa
Observed MW	58-68kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:200 - 1:800 FC (intra) 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	NK-92
Cellular location	Nucleus.