제품 > 항체 > 단일클론항체(mAb)

Thioredoxin 2 (Trx2/TXN2) Rabbit mAb (A4424)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Thioredoxin 2 (Trx2/TXN2)Rabbit mAb (A4424) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - Thioredoxin 2 (Trx2/TXN2) Rabbit mAb (A4424)

Immunofluorescence analysis of NIH-3T3 cells using Thioredoxin 2 (Trx2/TXN2) (Trx2/TXN2) Rabbit mAb (A4424) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	Thioredoxin 2 (Trx2/TXN2) Rabbit mAb
Catalog No.	A4424
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1003

Background

This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 67-166 of human TXN2 (Q99757).
Sequence	GPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG
Gene ID
Swiss Prot
Synonyms	TXN; MTRX; TRX2; MT-TRX; COXPD29
Calculated MW	18kDa
Observed MW	13kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HepG2, BxPC-3, Jurkat, Mouse liver, Mouse brain, Mouse spleen, Rat liver, Rat kidney
Cellular location	Mitochondrion
Customer validation	IP(Mus musculus) WB(Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구내분비 & 대사미토콘드리아 대사미토콘드리아 마커

Thioredoxin 2 (Trx2/TXN2) Rabbit mAb images

Western blot - Thioredoxin 2 (Trx2/TXN2) Rabbit mAb (A4424)

Immunofluorescence - Thioredoxin 2 (Trx2/TXN2) Rabbit mAb (A4424)

Immunofluorescence analysis of NIH-3T3 cells using Thioredoxin 2 (Trx2/TXN2) (Trx2/TXN2) Rabbit mAb (A4424) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.