Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Western blot analysis of extracts of various cell lines, using Thioredoxin 2 (Trx2/Thioredoxin 2 (Trx2/TXN2)) antibody (A6782) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of NIH/3T3 cells using Thioredoxin 2 (Trx2/TXN2) Rabbit pAb (A6782) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
| Product name | Thioredoxin 2 (Trx2/TXN2) Rabbit pAb |
|---|---|
| Catalog No. | A6782 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human Thioredoxin 2 (Trx2/Thioredoxin 2 (Trx2/TXN2)) (NP_036605.2). |
|---|---|
| Sequence | MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG |
| Gene ID | |
| Swiss Prot | |
| Synonyms | TXN; MTRX; TRX2; MT-TRX; COXPD29 |
| Calculated MW | 18kDa |
| Observed MW | 13kDa |
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | Raji, 293T, SW620, THP-1 |
| Cellular location | Mitochondrion |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
