제품 > 항체 > 다중클론항체(pAb)

Timm22 Rabbit pAb (A20813)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Timm22 Rabbit pAb (A20813) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunoprecipitation - Timm22 Rabbit pAb (A20813)

Immunoprecipitation analysis of 600 μg extracts of Rat brain cells using 3 μg Timm22 antibody (A20813). Western blot was performed from the immunoprecipitate using Timm22 antibody (A20813) at a dilution of 1:500.

Overview

Product name	Timm22 Rabbit pAb
Catalog No.	A20813
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable mitochondrion targeting sequence binding activity and protein transmembrane transporter activity. Predicted to be involved in protein insertion into mitochondrial inner membrane. Predicted to act upstream of or within protein transport. Located in mitochondrion. Is expressed in several structures, including alimentary system; brain; cardiovascular system; egg cylinder; and genitourinary system. Human ortholog(s) of this gene implicated in combined oxidative phosphorylation deficiency 43. Orthologous to human TIMM22 (translocase of inner mitochondrial membrane 22).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 19-121 of mouse Timm22 (NP_062792.2).
Sequence	AEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIERAMESCAFKAVLACVGGFVLGGAFGIFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQR
Gene ID
Swiss Prot
Synonyms	Tim22; Timm22
Calculated MW	20kDa
Observed MW	20kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	T47D, Mouse brain, Rat testis, Rat brain
Cellular location	mitochondrial inner membrane, mitochondrion