Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | Timm29 Rabbit pAb |
---|---|
Catalog No. | A20812 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 157-266 of mouse Timm29 (NP_848734.1). |
---|---|
Sequence | YLQPRWVDFPGRILDVGFVGRWWILQNRMHDCDINDDEFLHLPAHLRVVAPHQLHSEANERLFEEKYKPIILTDDQVDQALWEEQVLQKERKDRLALSEADSLVQSDVSR |
Gene ID | |
Swiss Prot | |
Synonyms | TIM29; 1810026J23Rik; Timm29 |
Calculated MW | 29kDa |
Observed MW | 29kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | 293T, A-549, PC-3, Mouse liver |
Cellular location | mitochondrial inner membrane, mitochondrial intermembrane space |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.