제품 > 항체 > 단일클론항체(mAb)

TorsinA/TOR1A Rabbit mAb (A9579)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using TorsinA/TOR1A antibody (A9579) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Overview

Product name	TorsinA/TOR1A Rabbit mAb
Catalog No.	A9579
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1645

Background

The protein encoded by this gene is a member of the AAA family of adenosine triphosphatases (ATPases), is related to the Clp protease/heat shock family and is expressed prominently in the substantia nigra pars compacta. Mutations in this gene result in the autosomal dominant disorder, torsion dystonia 1.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 233-332 of human TorsinA/TOR1A (O14656).
Sequence	LKDIEHALSVSVFNNKNSGFWHSSLIDRNLIDYFVPFLPLEYKHLKMCIRVEMQSRGYEIDEDIVSRVAEEMTFFPKEERVFSDKGCKTVFTKLDYYYDD
Gene ID
Swiss Prot
Synonyms	DQ2; AMC5; DYT1
Calculated MW	38kDa
Observed MW	38kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T, HepG2, U-87MG, Mouse liver, Mouse brain, Mouse spleen, Rat lung
Cellular location	Cytoskeleton, Cytosol, Endoplasmic reticulum, Endoplasmic reticulum lumen, Extracellular exosome, Growth cone, Nuclear envelope, Synaptic vesicle