Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Transferrin Rabbit mAb |
---|---|
Catalog No. | A19130 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0338 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Transferrin (P02787). |
---|---|
Sequence | PSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIP |
Gene ID | |
Swiss Prot | |
Synonyms | TFQTL1; PRO1557; PRO2086; HEL-S-71p; Transferrin |
Calculated MW | 77kDa |
Observed MW | 77kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Human serum |
Cellular location | Secreted. |
Customer validation | WB(Homo sapiens, Other) IHC(Homo sapiens) IHC(Gallus gallus, Homo sapiens, Mus musculus) WB(Homo sapiens,Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19130? Please let us know so that we can cite the reference in this datasheet.