제품 > 항체 > 단일클론항체(mAb)

AMPKa1/AMPKa2 Mouse mAb (A27099)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using AMPKa1/AMPKa2 Mouse mAb (A27099) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

ABclonal:Immunohistochemistry - AMPKa1/AMPKa2 Mouse mAb (A27099)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using AMPKa1/AMPKa2 Mouse mAb (A27099) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using AMPKa1/AMPKa2 Mouse mAb (A27099) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using AMPKa1/AMPKa2 Mouse mAb (A27099) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using AMPKa1/AMPKa2 Mouse mAb (A27099) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat heart tissue using AMPKa1/AMPKa2 Mouse mAb (A27099) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Overview

Product name	AMPKa1/AMPKa2 Mouse mAb
Catalog No.	A27099
Host species	Mouse
Purification method	Affinity purification
Isotype	IgG2a κ
CloneNo.	AMC0695

Background

The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 251-550 of human AMPKα1 (Q13131).
Sequence	SVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMC
Gene ID
Swiss Prot
Synonyms	AMPKa1/AMPKa2
Calculated MW	64kDa/65kDa
Observed MW	63kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:100 - 1:500 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at 4℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.1% Sodium azide, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	MCF7, K-562, Jurkat
Cellular location	apical plasma membrane, cytoplasm, cytosol, nuclear speck, nucleoplasm, nucleus.