제품 > 항체 > 다중클론항체(pAb)

Cytokeratin 5 Rabbit pAb (A2662)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using Cytokeratin 5 Rabbit pAb (A2662) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - Cytokeratin 5 Rabbit pAb (A2662)

Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using Cytokeratin 5 Rabbit pAb (A2662) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

ABclonal:Immunofluorescence - Cytokeratin 5 Rabbit pAb (A2662)

Immunofluorescence analysis of L929 cells using Cytokeratin 5 Rabbit pAb (A2662) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - Cytokeratin 5 Rabbit pAb (A2662)

Immunoprecipitation analysis of 200 μg extracts of A-431 cells using 3 μg Cytokeratin 5 antibody (A2662). Western blot was performed from the immunoprecipitate using Cytokeratin 5 antibody (A2662) at a dilution of 1:5000.

Overview

Product name	Cytokeratin 5 Rabbit pAb
Catalog No.	A2662
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the basal layer of the epidermis with family member KRT14. Mutations in these genes have been associated with a complex of diseases termed epidermolysis bullosa simplex. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 5 (KRT5) (NP_000415.2).
Sequence	MSRQSSVSFRSGGSRSFSTASAITPSVSRTSFTSVSRSGGGGGGGFGRVSLAGACGVGGYGSRSLYNLGGSKRISISTSGGSFRNRFGAGAGGGYGFGGG
Gene ID
Swiss Prot
Synonyms	K5; CK5; DDD; DDD1; EBS1; EBS2; EBS2A; EBS2B; EBS2C; EBS2D; EBS2E; EBS2F; KRT5A; Cytokeratin 5 (KRT5)
Calculated MW	62kDa
Observed MW	62kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	A375, PC-3
Cellular location	cytoplasm, cytosol, extracellular exosome, nucleus.
Customer validation	IHC(Mus musculus, Homo sapiens) IF(Homo sapiens)