Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | TrkA+B+C Rabbit mAb |
---|---|
Catalog No. | A2693 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2649 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 722-822 of human NTRK2 (Q16620 ). |
---|---|
Sequence | PESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG |
Gene ID | |
Swiss Prot | |
Synonyms | MTC; TRK; TRK1; TRKA; Trk-A; p140-TrkA; TRKC; GP145-TrkC; gp145(trkC); OBHD; TRKB; DEE58; trk-B; EIEE58; GP145-TrkB; TrkA+B+C |
Calculated MW | 140kDa |
Observed MW |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | SH-SY5Y, Mouse brain, Rat brain |
Cellular location | Axon, dendrite, early endosome, late endosome, plasma membrane |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.