Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | Troponin I2 (TNNI2) Rabbit pAb |
---|---|
Catalog No. | A7937 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Troponin I2 (Troponin I2 (TNNI2)) (NP_003273.1). |
---|---|
Sequence | MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL |
Gene ID | |
Swiss Prot | |
Synonyms | DA2B; FSSV; DA2B1; fsTnI; AMCD2B |
Calculated MW | 21kDa |
Observed MW | 21kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse skeletal muscle, Rat skeletal muscle |
Cellular location | cytosol, nucleus |
Customer validation | WB(Sus scrofa, Ovis aries) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7937? Please let us know so that we can cite the reference in this datasheet.