Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | Tspan18 Rabbit pAb |
---|---|
Catalog No. | A20275 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 149-248 of mouse Tspan18 (NP_899003.1). |
---|---|
Sequence | GVNGPEDFKLASVFRLLTLDTEEVPKACCRREPQTRDGVVLSREECQLGRNPFINKQGCYTVILNTFETYVYLAGAFAIGVLAIELFLMVFAMCLFRGIQ |
Gene ID | |
Swiss Prot | |
Synonyms | 6720430O15; 2610042G18Rik; Tspan18 |
Calculated MW | 28kDa |
Observed MW | 28kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse brain, Rat brain |
Cellular location | plasma membrane |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.