제품 > 항체 > 단일클론항체(mAb)

Tubulin beta-1 chain Rabbit mAb (A19805)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat, Cow, Dog, Monkey

Western blot analysis of extracts of various cell lines, using Tubulin beta-1 chain Rabbit mAb (A19805) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - Tubulin beta-1 chain Rabbit mAb (A19805)

Immunofluorescence analysis of C6 cells using Tubulin beta-1 chain Rabbit mAb (A19805) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using Tubulin beta-1 chain Rabbit mAb (A19805) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using Tubulin beta-1 chain Rabbit mAb (A19805) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	Tubulin beta-1 chain Rabbit mAb
Catalog No.	A19805
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2484

Background

This gene encodes a member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is specifically expressed in platelets and megakaryocytes and may be involved in proplatelet production and platelet release. A mutations in this gene is associated with autosomal dominant macrothrombocytopenia. Two pseudogenes of this gene are found on chromosome Y.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 352-451 of human Tubulin beta-1 chain (Q9H4B7).
Sequence	AVCDIPPRGLSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH
Gene ID
Swiss Prot
Synonyms	MACTHC1
Calculated MW	50kDa
Observed MW	50kDa

Applications

Reactivity	Human, Mouse, Rat, Cow, Dog, Monkey
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	A-549, K-562
Cellular location	cytoplasm, extracellular exosome, intercellular bridge, microtubule cytoskeleton, mitotic spindle

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Tubulin beta-1 chain Rabbit mAb images

Western blot - Tubulin beta-1 chain Rabbit mAb (A19805)

Immunofluorescence - Tubulin beta-1 chain Rabbit mAb (A19805)

Immunofluorescence analysis of C6 cells using Tubulin beta-1 chain Rabbit mAb (A19805) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence - Tubulin beta-1 chain Rabbit mAb (A19805)

Immunofluorescence analysis of NIH-3T3 cells using Tubulin beta-1 chain Rabbit mAb (A19805) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence - Tubulin beta-1 chain Rabbit mAb (A19805)

Immunofluorescence analysis of U-2 OS cells using Tubulin beta-1 chain Rabbit mAb (A19805) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.