제품 > 항체 > 단일클론항체(mAb)

U1A/SNRPA Rabbit mAb (A3686)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using U1A/SNRPA Rabbit mAb (A3686) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - U1A/SNRPA Rabbit mAb (A3686)

Immunofluorescence analysis of U-2 OS cells using U1A/SNRPA Rabbit mAb (A3686) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - U1A/SNRPA Rabbit mAb (A3686)

Immunoprecipitation of U1A/SNRPA from 300 µg extracts of HeLa cells was performed using 3 µg of U1A/SNRPA Rabbit mAb (A3686). Rabbit IgG isotype control(AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using U1A/SNRPA Rabbit mAb (A3686) at a dilution of 1:1000.

Overview

Product name	U1A/SNRPA Rabbit mAb
Catalog No.	A3686
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0823

Background

The protein encoded by this gene associates with stem loop II of the U1 small nuclear ribonucleoprotein, which binds the 5' splice site of precursor mRNAs and is required for splicing. The encoded protein autoregulates itself by polyadenylation inhibition of its own pre-mRNA via dimerization and has been implicated in the coupling of splicing and polyadenylation.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human U1A/SNRPA (P09012).
Sequence	MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT
Gene ID
Swiss Prot
Synonyms	U1A; Mud1; U1-A; U1A/SNRPA
Calculated MW	31kDa
Observed MW	35kDa/

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HeLa, U-937, Rat brain, HeLa
Cellular location	Nucleus