제품 > 항체 > 다중클론항체(pAb)

U2AF1 Rabbit pAb (A13166)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using U2AF1 Rabbit pAb (A13166) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - U2AF1 Rabbit pAb (A13166)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using U2AF1 Rabbit pAb (A13166) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - U2AF1 Rabbit pAb (A13166)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg U2AF1 antibody (A13166). Western blot was performed from the immunoprecipitate using U2AF1 antibody (A13166) at a dilution of 1:1000.

Overview

Product name	U2AF1 Rabbit pAb
Catalog No.	A13166
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the small subunit which plays a critical role in both constitutive and enhancer-dependent RNA splicing by directly mediating interactions between the large subunit and proteins bound to the enhancers. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human U2AF1 (NP_006749.1).
Sequence	MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMN
Gene ID
Swiss Prot
Synonyms	RN; FP793; U2AF35; U2AFBP; RNU2AF1; U2AF1
Calculated MW	28kDa
Observed MW	38kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:100 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	293T, HeLa, K-562, LO2, Mouse spleen, Mouse kidney, Rat spleen
Cellular location	Nucleus, Nucleus speckle