제품 > 항체 > 다중클론항체(pAb)

U2AF2/U2AF65 Rabbit pAb (A1936)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using U2AF2/U2AF65 Rabbit pAb (A1936) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - U2AF2/U2AF65 Rabbit pAb (A1936)

Immunofluorescence analysis of U2OS cells using U2AF2/U2AF65 Rabbit pAb (A1936). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - U2AF2/U2AF65 Rabbit pAb (A1936)

Immunoprecipitation analysis of 200 μg extracts of SW620 cells using 1 μg U2AF2/U2AF65 antibody (A1936). Western blot was performed from the immunoprecipitate using U2AF2/U2AF65 antibody (A1936) at a dilution of 1:500.

Review

Overview

Product name	U2AF2/U2AF65 Rabbit pAb
Catalog No.	A1936
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

U2 auxiliary factor (U2AF), comprised of a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the U2AF large subunit which contains a sequence-specific RNA-binding region with 3 RNA recognition motifs and an Arg/Ser-rich domain necessary for splicing. The large subunit binds to the polypyrimidine tract of introns early during spliceosome assembly. Multiple transcript variants have been detected for this gene, but the full-length natures of only two have been determined to date.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 192-471 of human U2AF2/U2AF65 (NP_001012496.1).
Sequence	NQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW
Gene ID
Swiss Prot
Synonyms	U2AF65; U2AF2/U2AF65
Calculated MW	54kDa
Observed MW	54kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:100 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	Jurkat, SW620, Mouse spleen
Cellular location	Nucleus
Customer validation	(Human cells)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구후성유전학 & 핵 신호전달RNA 결합

U2AF2/U2AF65 Rabbit pAb images

Western blot - U2AF2/U2AF65 Rabbit pAb (A1936)

Immunofluorescence - U2AF2/U2AF65 Rabbit pAb (A1936)

Immunofluorescence analysis of U2OS cells using U2AF2/U2AF65 Rabbit pAb (A1936). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunoprecipitation - U2AF2/U2AF65 Rabbit pAb (A1936)

* For research use only. Not for therapeutic or diagnostic purposes.