제품 > 항체 > 다중클론항체(pAb)

UBA6 Rabbit pAb (A7511)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using UBA6 Rabbit pAb (A7511) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - UBA6 Rabbit pAb (A7511)

Immunofluorescence analysis of A549 cells using UBA6 Rabbit pAb (A7511). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - UBA6 Rabbit pAb (A7511)

Immunoprecipitation analysis of 200 μg extracts of 293T cells, using 3 μg UBA6 antibody (A7511). Western blot was performed from the immunoprecipitate using UBA6 antibody (A7511) at a dilution of 1:1000.

Overview

Product name	UBA6 Rabbit pAb
Catalog No.	A7511
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Modification of proteins with ubiquitin (UBB; MIM 191339) or ubiquitin-like proteins controls many signaling networks and requires a ubiquitin-activating enzyme (E1), a ubiquitin conjugating enzyme (E2), and a ubiquitin protein ligase (E3). UBE1L2 is an E1 enzyme that initiates the activation and conjugation of ubiquitin-like proteins (Jin et al., 2007 [PubMed 17597759]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human UBA6 (NP_060697.4).
Sequence	MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLNGSI
Gene ID
Swiss Prot
Synonyms	E1-L2; MOP-4; UBE1L2; UBA6
Calculated MW	118kDa
Observed MW	59kDa, 118kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	U-251MG, SKOV3, 293T, Mouse brain
Cellular location	cytoplasm, cytosol, nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구세포 생물학 & 발달 생물학유비퀴틴유비퀴틴-프로테아좀 신호전달 경로

UBA6 Rabbit pAb images

Western blot - UBA6 Rabbit pAb (A7511)

Immunofluorescence - UBA6 Rabbit pAb (A7511)

Immunofluorescence analysis of A549 cells using UBA6 Rabbit pAb (A7511). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunoprecipitation - UBA6 Rabbit pAb (A7511)

* For research use only. Not for therapeutic or diagnostic purposes.