제품 > 항체 > 다중클론항체(pAb)

UBAC2 Rabbit pAb (A15977)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of various lysates using UBAC2 Rabbit pAb (A15977) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Overview

Product name	UBAC2 Rabbit pAb
Catalog No.	A15977
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Involved in negative regulation of canonical Wnt signaling pathway and negative regulation of retrograde protein transport, ER to cytosol. Acts upstream of or within protein localization to endoplasmic reticulum. Located in endoplasmic reticulum.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 220-310 of human UBAC2 (NP_001137544.1).
Sequence	PIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQV
Gene ID
Swiss Prot
Synonyms	PHGDHL1; UBAC2
Calculated MW	39kDa
Observed MW	39kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse kidney, Mouse brain
Cellular location	Endoplasmic reticulum membrane, Multi-pass membrane protein