Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | UBE2K Rabbit pAb |
---|---|
Catalog No. | A1086 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE2K (NP_005330.1). |
---|---|
Sequence | MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQW |
Gene ID | |
Swiss Prot | |
Synonyms | LIG; HIP2; HYPG; UBC1; E2-25K |
Calculated MW | 22kDa |
Observed MW | 22kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 22Rv1, SKOV3, SW480, HL-60, Raji, U-251MG, MCF7 |
Cellular location | Cytoplasm |
* For research use only. Not for therapeutic or diagnostic purposes.