제품 > 항체 > 다중클론항체(pAb)

UBE2V2 Rabbit pAb (A6998)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using UBE2V2 Rabbit pAb (A6998) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - UBE2V2 Rabbit pAb (A6998)

Immunohistochemistry analysis of paraffin-embedded Rat spleen using UBE2V2 Rabbit pAb (A6998) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	UBE2V2 Rabbit pAb
Catalog No.	A6998
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Ubiquitin-conjugating enzyme E2 variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene also shares homology with ubiquitin-conjugating enzyme E2 variant 1 and yeast MMS2 gene product. It may be involved in the differentiation of monocytes and enterocytes.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human UBE2V2 (NP_003341.1).
Sequence	MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
Gene ID
Swiss Prot
Synonyms	MMS2; UEV2; EDPF1; UEV-2; DDVIT1; EDAF-1; EDPF-1; DDVit-1; UBE2V2
Calculated MW	16kDa
Observed MW	16kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	SW480, SKOV3, HeLa, HL-60, Mouse liver, Mouse skin, Rat liver, Rat brain
Cellular location	cytoplasm, extracellular exosome, nucleoplasm, nucleus