제품 > 항체 > 다중클론항체(pAb)

UBQLN4 Rabbit pAb (A15869)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using UBQLN4 Rabbit pAb (A15869) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - UBQLN4 Rabbit pAb (A15869)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using UBQLN4 Rabbit pAb (A15869) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human placenta using UBQLN4 Rabbit pAb (A15869) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse lung using UBQLN4 Rabbit pAb (A15869) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat brain using UBQLN4 Rabbit pAb (A15869) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - UBQLN4 Rabbit pAb (A15869)

Immunofluorescence analysis of PC-12 cells using UBQLN4 Rabbit pAb (A15869) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	UBQLN4 Rabbit pAb
Catalog No.	A15869
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables K48-linked polyubiquitin modification-dependent protein binding activity and identical protein binding activity. Involved in cellular response to DNA damage stimulus; negative regulation of double-strand break repair via homologous recombination; and regulation of cellular catabolic process. Located in several cellular components, including autophagosome; nucleoplasm; and site of DNA damage. Part of protein-containing complex. Colocalizes with cytosolic proteasome complex and nuclear proteasome complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 366-432 of human UBQLN4 (NP_064516.2).
Sequence	FGINAASLGSGMFNSPEMQALLQQISENPQLMQNVISAPYMRSMMQTLAQNPDFAAQMMVNVPLFAG
Gene ID
Swiss Prot
Synonyms	A1U; A1Up; UBIN; CIP75; C1orf6; UBQLN4
Calculated MW	64kDa
Observed MW	75kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	BxPC-3, RD, SH-SY5Y, Mouse testis, Mouse thymus, Rat kidney
Cellular location	Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum, Nucleus, autophagosome, perinuclear region