Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | UCP2 Rabbit pAb |
---|---|
Catalog No. | A4178 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 112-211 of human UCP2 (NP_003346.2). |
---|---|
Sequence | EHASIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDLIKDALLKANLMT |
Gene ID | |
Swiss Prot | |
Synonyms | UCPH; BMIQ4; SLC25A8; UCP2 |
Calculated MW | 33kDa |
Observed MW | 32kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Raji, A-549, HT-29, RAW264.7, Mouse heart, Rat heart |
Cellular location | Mitochondrion inner membrane, Multi-pass membrane protein. |
Customer validation | WB(Mus musculus, Homo sapiens) IHC(Homo sapiens) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A4178? Please let us know so that we can cite the reference in this datasheet.