제품 > 항체 > 단일클론항체(mAb)

UFM1 Rabbit mAb (A20875)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using UFM1 Rabbit mAb (A20875) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - UFM1 Rabbit mAb (A20875)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using UFM1 Rabbit mAb (A20875) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	UFM1 Rabbit mAb
Catalog No.	A20875
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2816

Background

UFM1 is a ubiquitin-like protein that is conjugated to target proteins by E1-like activating enzyme UBA5 (UBE1DC1; MIM 610552) and E2-like conjugating enzyme UFC1 (MIM 610554) in a manner analogous to ubiquitylation (see UBE2M; MIM 603173) (Komatsu et al., 2004 [PubMed 15071506]).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-85 of human UFM1 (P61960).
Sequence	MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC
Gene ID
Swiss Prot
Synonyms	HLD14; BM-002; C13orf20; UFM1
Calculated MW	9kDa
Observed MW	10kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HepG2, HL-60, SH-SY5Y, Mouse brain, Mouse spleen, Mouse pancreas, Rat brain, Rat spleen, Rat pancreas
Cellular location	Cytoplasm, Nucleus