제품 > 항체 > 다중클론항체(pAb)

UIMC1 Rabbit pAb (A7244)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using UIMC1 Rabbit pAb (A7244) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from HeLa cells using UIMC1 Rabbit pAb (A7244) at 1:3000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 60 s.

ABclonal:Immunofluorescence - UIMC1 Rabbit pAb (A7244)

Immunofluorescence analysis of GFP-RNF168 transgenic U2OS cells using UIMC1 Rabbit pAb (A7244). Green：GFP-RNF168 fusion protein expression for DNA damage marker.Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.RNF168(GFP) can be used to mark cells damaged by UV-A laser for they always gather around DNA damage region.

Review

Overview

Product name	UIMC1 Rabbit pAb
Catalog No.	A7244
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a nuclear protein that interacts with Brca1 (breast cancer 1) in a complex to recognize and repair DNA lesions. This protein binds ubiquitinated lysine 63 of histone H2A and H2AX. This protein may also function as a repressor of transcription. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human UIMC1 (NP_057374.3).
Sequence	MPRRKKKVKEVSESRNLEKKDVETTSSVSVKRKRRLEDAFIVISDSDGEEPKEENGLQKTKTKQSNRAKCLAKRKIAQMTEEEQFALALKMSEQEAREVNSQEEEEEELLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDS
Gene ID
Swiss Prot
Synonyms	RAP80; X2HRIP110; UIMC1
Calculated MW	80kDa
Observed MW	120kDa/100kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:100 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	MCF7, 293T, Mouse thymus, Rat brain, HeLa
Cellular location	Nucleus.
Customer validation	(human cells) WB(Mus musculus) IF(Mus musculus)