Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ULK1 Rabbit pAb |
---|---|
Catalog No. | A8529 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human ULK1 (NP_003556.1). |
---|---|
Sequence | SSCDTDDFVMVPAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGPFSSSRCGASVPIPVPTQVQNYQRIERNLQS |
Gene ID | |
Swiss Prot | |
Synonyms | ATG1; ATG1A; UNC51; hATG1; Unc51.1; ULK1 |
Calculated MW | 113kDa |
Observed MW | 150kDa/140kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | 293T, HepG2, Rat brain, Mouse thymus, Rat testis |
Cellular location | Cytoplasm, Preautophagosomal structure, cytosol |
Customer validation | WB(Homo sapiens, Mus musculus, Spodoptera frugiperda, Sus scrofa, Fathead minnow, Horabagrus nigricollaris, Gallus gallus) IHC(Mus musculus) IHC(Ctenopharyngodon idellus) WB(Ctenopharyngodon idellus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A8529? Please let us know so that we can cite the reference in this datasheet.