제품 > 항체 > 다중클론항체(pAb)

UNC93B1 Rabbit pAb (A15250)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using UNC93B1 Rabbit pAb (A15250) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15S.

Overview

Product name	UNC93B1 Rabbit pAb
Catalog No.	A15250
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein that is involved in innate and adaptive immune response by regulating toll-like receptor signaling. The encoded protein traffics nucleotide sensing toll-like receptors to the endolysosome from the endoplasmic reticulum. Deficiency of the encoded protein has been associated with herpes simplex encephalitis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 450-550 of human UNC93B1 (NP_112192.2).
Sequence	KTGLSTLLGILYEDKERQDFIFTIYHWWQAVAIFTVYLGSSLHMKAKLAVLLVTLVAAAVSYLRMEQKLRRGVAPRQPRIPRPQHKVRGYRYLEEDNSDES
Gene ID
Swiss Prot
Synonyms	IIAE1; UNC93; UNC93B; Unc-93B1; UNC93B1
Calculated MW	67kDa
Observed MW	70kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T, HeLa, Mouse kidney, Mouse lung, Mouse spleen, Rat kidney, Rat lung, Rat spleen
Cellular location	Cytoplasmic vesicle, Endoplasmic reticulum membrane, Endosome, Lysosome, Multi-pass membrane protein, phagosome.
Customer validation	IP(Homo sapiens) WB(Homo sapiens)