제품 > 항체 > 다중클론항체(pAb)

UQCC2 Rabbit pAb (A9986)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using UQCC2 Rabbit pAb (A9986) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - UQCC2 Rabbit pAb (A9986)

Immunohistochemistry analysis of paraffin-embedded Rat spleen using UQCC2 Rabbit pAb (A9986) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Rat heart using UQCC2 Rabbit pAb (A9986) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse heart using UQCC2 Rabbit pAb (A9986) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	UQCC2 Rabbit pAb
Catalog No.	A9986
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a nucleoid protein localized to the mitochondria inner membrane. The encoded protein affects regulation of insulin secretion, mitochondrial ATP production, and myogenesis through modulation of mitochondrial respiratory chain activity.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 14-126 of human UQCC2 (NP_115716.1).
Sequence	EEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARLHSNYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA
Gene ID
Swiss Prot
Synonyms	M19; Cbp6; MNF1; MC3DN7; C6orf125; C6orf126; bA6B20.2; UQCC2
Calculated MW	15kDa
Observed MW	15kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	MCF7, THP-1, HepG2, U-251MG, Mouse heart, Mouse brain, Mouse testis, Rat brain
Cellular location	Mitochondrion, Mitochondrion inner membrane, Mitochondrion intermembrane space, Mitochondrion matrix, mitochondrion nucleoid