제품 > 항체 > 단일클론항체(mAb)

UQCRFS1 Rabbit mAb (A9517)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using UQCRFS1 Rabbit mAb (A9517) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - UQCRFS1 Rabbit mAb (A9517)

Immunofluorescence analysis of C6 cells using UQCRFS1 Rabbit mAb (A9517) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using UQCRFS1 Rabbit mAb (A9517) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using UQCRFS1 Rabbit mAb (A9517) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	UQCRFS1 Rabbit mAb
Catalog No.	A9517
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1612

Background

Predicted to enable oxidoreductase activity. Involved in mitochondrial respiratory chain complex III assembly and respiratory electron transport chain. Located in mitochondrion. Part of mitochondrial respiratory chain complex III and mitochondrial respiratory chain complex IV. Implicated in mitochondrial complex III deficiency.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 175-274 of human UQCRFS1 (P47985).
Sequence	FVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG
Gene ID
Swiss Prot
Synonyms	RIP1; RIS1; RISP; UQCR5; MC3DN10
Calculated MW	30kDa
Observed MW	22kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	A-549, Raji, U-251MG, Mouse liver, Mouse heart, Rat testis, Rat heart
Cellular location	Mitochondrion inner membrane, Single-pass membrane protein