제품 > 항체 > 단일클론항체(mAb)

USP14 Rabbit mAb (A19589)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using USP14 Rabbit mAb (A19589) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunoprecipitation - USP14 Rabbit mAb (A19589)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg USP14 antibody (A19589). Western blot was performed from the immunoprecipitate using USP14 antibody (A19589) at a dilution of 1:2000.

Overview

Product name	USP14 Rabbit mAb
Catalog No.	A19589
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2185

Background

This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 371-473 of human USP14 (P54578).
Sequence	RSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWH
Gene ID
Swiss Prot
Synonyms	TGT; Ubp6; USP14
Calculated MW	56kDa
Observed MW	60kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa, HCT 116, U-251MG, Mouse brain, Rat brain
Cellular location	cell surface, cytoplasmic vesicle, cytosol, extracellular exosome, plasma membrane
Customer validation	WB(Homo sapiens,Mus musculus)